Recombinant Human Sulfatase Modifying Factor 1/SUMF1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, 10% Glycerol, pH 7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDVDHHHHHH |
Source: Human Cells.
MW :38.27kD.
Recombinant Human SUMF1 is produced by our Mammalian expression system and the target gene encoding Ser34-Asp374 is expressed with a 6His tag at the C-terminus. Human Sulfatase Modifying Factor 1 (SUMF1) is a 42kDa protein. SUMF1 is a Ca2+-binging member of the sulfatase-modifying factor family. SUMF1 is a soluble ER lumenal glycoprotein, it converts inactive sulfatases into an active form by transforming a catalytic site cysteine into a formylglycine residue. In the ER, SUMF1 can exist as either a monomer, or a disulfide-linked homodimer or a heterodimer with SUMF2. Three splice isoforms are known.
MW :38.27kD.
Recombinant Human SUMF1 is produced by our Mammalian expression system and the target gene encoding Ser34-Asp374 is expressed with a 6His tag at the C-terminus. Human Sulfatase Modifying Factor 1 (SUMF1) is a 42kDa protein. SUMF1 is a Ca2+-binging member of the sulfatase-modifying factor family. SUMF1 is a soluble ER lumenal glycoprotein, it converts inactive sulfatases into an active form by transforming a catalytic site cysteine into a formylglycine residue. In the ER, SUMF1 can exist as either a monomer, or a disulfide-linked homodimer or a heterodimer with SUMF2. Three splice isoforms are known.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum lumen |
| Post transnational modification: | N-glycosylated. Contains high-mannose-type oligosaccharides. |
| Tissue Specificity: | Ubiquitous. Highly expressed in kidney, pancreas and liver. Detected at lower levels in leukocytes, lung, placenta, small intestine, skeletal muscle and heart. |
| BioGrid: | 130091. 19 interactions. |
|
There are currently no product reviews
|




















.png)







