Recombinant Human Sulfotransferase 1B1/SULT1B1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MNHKVHHHHHHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI |
Source: E. coli.
MW :36.3kD.
Recombinant Human Sulfotransferase 1B1 is produced by our E.coli expression system and the target gene encoding Met1-Ile296 is expressed with a 6His tag at the N-terminus. Sulfotransferase Family Cytosolic 1B Member 1 (SULT1B1) is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. Human SULT1B1 is a 296 amino acid protein that is highly expressed in the liver, peripheral blood leukocytes, colon, small intestine, and spleen. SULT1B1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it can catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.
MW :36.3kD.
Recombinant Human Sulfotransferase 1B1 is produced by our E.coli expression system and the target gene encoding Met1-Ile296 is expressed with a 6His tag at the N-terminus. Sulfotransferase Family Cytosolic 1B Member 1 (SULT1B1) is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. Human SULT1B1 is a 296 amino acid protein that is highly expressed in the liver, peripheral blood leukocytes, colon, small intestine, and spleen. SULT1B1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it can catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Highly expressed in the liver, peripheral blood leukocytes, colon (mucosal lining), small intestine (jejunum) and spleen. A lesser expression was observed in the lung, placenta and thymus. |
| BioGrid: | 118108. 4 interactions. |
|
There are currently no product reviews
|












.png)







