Recombinant Human Sulfotransferase 2A1/SULT2A1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE |
Source: E. coli.
MW :35.2kD.
Recombinant Human Sulfotransferase 2A1 is produced by our E.coli expression system and the target gene encoding Ser2-Glu285 is expressed with a 6His tag at the N-terminus. Bile Salt Sulfotransferase (SULT2A1( is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. SULT2A1 is primarily expressed in the liver and adrenal tissues, and to a lesser extent in the kidney. SULT2A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. SULT2A1 may have a role in the inherited adrenal androgen excess.
MW :35.2kD.
Recombinant Human Sulfotransferase 2A1 is produced by our E.coli expression system and the target gene encoding Ser2-Glu285 is expressed with a 6His tag at the N-terminus. Bile Salt Sulfotransferase (SULT2A1( is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. SULT2A1 is primarily expressed in the liver and adrenal tissues, and to a lesser extent in the kidney. SULT2A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. SULT2A1 may have a role in the inherited adrenal androgen excess.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Post transnational modification: | The N-terminus is blocked. |
| Tissue Specificity: | Liver, adrenal and at lower level in the kidney. Is present in human fetus in higher level in the adrenal than the liver and the kidney. |
| BioGrid: | 112691. 5 interactions. |
|
There are currently no product reviews
|
















.png)











