Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH |
Source: Human Cells.
MW :13.67kD.
Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus. Bone Marrow Stromal Antigen 2 (BST2) is a single-pass type II membrane protein that belongs to the tetherin family. BST2 is predominantly expressed in the liver, lung, heart and placenta. BST2 is involved in the sorting of secreted proteins. BST2 is a human cellular protein which inhibits retrovirus infection by preventing the diffusion of virus particles after budding from infected cells. BST2 is initially discovered as an inhibitor to HIV-1 infection in the absence of Vpu, it has also been shown to inhibit the release of other viruses such as retroviruses, filoviruses, arenaviruses, and herpes viruses. BST2 may play a role in B-cell activation in rheumatoid arthritis.
MW :13.67kD.
Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus. Bone Marrow Stromal Antigen 2 (BST2) is a single-pass type II membrane protein that belongs to the tetherin family. BST2 is predominantly expressed in the liver, lung, heart and placenta. BST2 is involved in the sorting of secreted proteins. BST2 is a human cellular protein which inhibits retrovirus infection by preventing the diffusion of virus particles after budding from infected cells. BST2 is initially discovered as an inhibitor to HIV-1 infection in the absence of Vpu, it has also been shown to inhibit the release of other viruses such as retroviruses, filoviruses, arenaviruses, and herpes viruses. BST2 may play a role in B-cell activation in rheumatoid arthritis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Golgi apparatus, Cell membrane, Cell membrane, Late endosome, Membrane raft, Cytoplasm, Apical cell membrane |
| Post transnational modification: | The GPI anchor is essential for its antiviral activity. |
| Tissue Specificity: | Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly expressed on T-cells, monocytes, NK cells and dendritic cells (at protein level). |
| BioGrid: | 107149. 16 interactions. |
|
There are currently no product reviews
|















.png)







