Recombinant Human Syndecan-2/SDC2/CD362 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris-Citrate, 150mM NaCl, pH 7.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVDHHHHHH |
Source: Human Cells.
MW :14.98kD.
Recombinant Human Syndecan-2 is produced by our Mammalian expression system and the target gene encoding Glu19-Glu144 is expressed with a 6His tag at the C-terminus. Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis.
MW :14.98kD.
Recombinant Human Syndecan-2 is produced by our Mammalian expression system and the target gene encoding Glu19-Glu144 is expressed with a 6His tag at the C-terminus. Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Post transnational modification: | O-glycosylated with core 1 or possibly core 8 glycans. Contains heparan sulfate. |
| BioGrid: | 112285. 90 interactions. |
|
There are currently no product reviews
|



















.png)







