Recombinant Human Prion-Like Protein Doppel/PRND (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGVDHHHHHH |
Source: Human Cells.
MW :15.5kD.
Recombinant Human Prion-like protein doppel is produced by our Mammalian expression system and the target gene encoding Arg27-Gly152 is expressed with a 6His tag at the C-terminus. Prion-like protein doppel is a 152 amino acids protein that belongs to the prion family. The protein encoded by this gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. It is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.
MW :15.5kD.
Recombinant Human Prion-like protein doppel is produced by our Mammalian expression system and the target gene encoding Arg27-Gly152 is expressed with a 6His tag at the C-terminus. Prion-like protein doppel is a 152 amino acids protein that belongs to the prion family. The protein encoded by this gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. It is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | O-glycosylated. |
| Tissue Specificity: | Expressed in testis, in Sertoli cells, ejaculated spermatozoa and in seminal fluid (at protein level). |
|
There are currently no product reviews
|












.png)







