Recombinant Human Teratocarcinoma-Derived Growth Factor 1/TDGF1/Cripto (C-Fc)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :42.8kD.
Recombinant Human Teratocarcinoma-derived growth factor 1 is produced by our Mammalian expression system and the target gene encoding Leu31-Ser169 is expressed with a Fc tag at the C-terminus. Teratocarcinoma-derived growth factor 1(TDGF1) is a Cell membrane protein and contains 1 EGF-like domain. The protein plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. It also may play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
MW :42.8kD.
Recombinant Human Teratocarcinoma-derived growth factor 1 is produced by our Mammalian expression system and the target gene encoding Leu31-Ser169 is expressed with a Fc tag at the C-terminus. Teratocarcinoma-derived growth factor 1(TDGF1) is a Cell membrane protein and contains 1 EGF-like domain. The protein plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. It also may play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Secreted |
| Post transnational modification: | The GPI-anchor is attached to the protein in the endoplasmic reticulum and serves to target the protein to the cell surface. There, it is processed by GPI processing phospholipase A2 (TMEM8A), removing an acyl-chain at the sn-2 position of GPI and releasing TDGF1 as a lysophosphatidylinositol-bearing form, which is further cleaved by phospholipase D (GPLD1) into a soluble form. |
| Tissue Specificity: | Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung. |
| BioGrid: | 112856. 31 interactions. |
|
There are currently no product reviews
|









.png)











