Recombinant Human Tissue Inhibitor of Metalloproteinases 2/TIMP-2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPVDHHHHHH |
Source: Human Cells.
MW :22.79kD.
Recombinant Human Tissue Inhibitor of Metalloproteinases 2 is produced by our Mammalian expression system and the target gene encoding Cys27-Pro220 is expressed with a 6His tag at the C-terminus. Tissue Inhibitor of Metalloproteinases 2 (TIMP-2) complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.
MW :22.79kD.
Recombinant Human Tissue Inhibitor of Metalloproteinases 2 is produced by our Mammalian expression system and the target gene encoding Cys27-Pro220 is expressed with a 6His tag at the C-terminus. Tissue Inhibitor of Metalloproteinases 2 (TIMP-2) complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The activity of TIMP2 is dependent on the presence of disulfide bonds. |
| BioGrid: | 112933. 9 interactions. |
|
There are currently no product reviews
|






















.png)







