Recombinant Human TMIGD2/IGPR-1/CD28H (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGVDHHHHHH |
Source: Human Cells.
MW :17.3kD.
Recombinant Human TMIGD2 is produced by our Mammalian expression system and the target gene encoding Leu23-Gly150 is expressed with a 6His tag at the C-terminus. TMIGD2 is a single-pass type I membrane protein, which contains one Ig-like (immunoglobulin-like) domain. It is widely expressed in many tissues, such as epithelial, endothelial cells and lung. However, it isnÂ’t detected in thyroid, cerebellum, thymus and cerebral cortex. TMIGD2 can form homophilic interactions that could regulate cell-cell interaction. It Interacts with CACNB2, DST, MIA and NCKIPSD. It is shown that TMIGD2 plays a role in cell-cell interaction, cell migration, and angiogenesis.
MW :17.3kD.
Recombinant Human TMIGD2 is produced by our Mammalian expression system and the target gene encoding Leu23-Gly150 is expressed with a 6His tag at the C-terminus. TMIGD2 is a single-pass type I membrane protein, which contains one Ig-like (immunoglobulin-like) domain. It is widely expressed in many tissues, such as epithelial, endothelial cells and lung. However, it isnÂ’t detected in thyroid, cerebellum, thymus and cerebral cortex. TMIGD2 can form homophilic interactions that could regulate cell-cell interaction. It Interacts with CACNB2, DST, MIA and NCKIPSD. It is shown that TMIGD2 plays a role in cell-cell interaction, cell migration, and angiogenesis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Widely expressed, mainly by epithelial and endothelial cells, including bronchial epithelial cells of lung, breast glandular and lobular epithelia cells, urothelium of the bladder, skin epidermis, epithelium of gastrointestinal, rectum, endometrial glands of the uterus, ureter, fallopian tube epithelium, colonic epithelium, small bowl epithelium, stomach epithelium, including both chief and parietal cells, trophoblastic epithelium of placenta, and pancreatic acinar cells (at protein level). Consistently expressed in veins and arteries (at protein level). Not detected in thyroid, cerebellum, cerebral cortex and thymus (at protein level). Expressed in lymphoid organs, with highest levels in thymus, spleen, peripheral blood lymphocytes and liver. In the thymus, expressed in CD4+ and CD8+ single- and double-positive cells, but not in immature CD4- and CD8- double-negative cells (at protein level). In peripheral blood mononuclear cells, highly expressed on CD56+ or CD16+ natural killer cells and CD3+ T-cells(at protein level). Not detected on B-cells(at protein level). Expressed in tonsils (at protein level). |
| BioGrid: | 125971. 1 interactions. |
|
There are currently no product reviews
|











.png)







