Recombinant Human Tumor Necrosis Factor Receptor I/TNFRSF1A/CD120a (N-6His)(Discontinued)
 
			Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg | 
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. | 
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. | 
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT | 
			Source: E.coli. 
MW :23.5kD.
Recombinant Human Tumor Necrosis Factor Receptor I is produced by our E.coli expression system and the target gene encoding Ile22-Thr211 is expressed with a 6His tag at the N-terminus. Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-kB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome
		
			    MW :23.5kD.
Recombinant Human Tumor Necrosis Factor Receptor I is produced by our E.coli expression system and the target gene encoding Ile22-Thr211 is expressed with a 6His tag at the N-terminus. Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-kB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. 
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted | 
| Post transnational modification: | The soluble form is produced from the membrane form by proteolytic processing. | 
| BioGrid: | 112986. 162 interactions. | 
| 
                    	There are currently no product reviews | 



 
		
			

















.png)





 
					



