Recombinant Human VIP36/LMAN2/GP36b (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 50mM TrisHCl,10mM GSH,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVDHHHHHH |
Source: Human Cells.
MW :32.7kD.
Recombinant Human Vesicular Integral-Membrane Protein VIP36 is produced by our Mammalian expression system and the target gene encoding Asp45-Arg322 is expressed with a 6His tag at the C-terminus. Vesicular integral-membrane protein VIP36 is also known as Glycoprotein GP36b, Lectin mannose-binding 2, Vesicular integral-membrane protein 36, LMAN2 and C5orf8. LMAN2 is widely expressed and contains one L-type lectin-like domain. LMAN2 binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. LMAN2 plays a role as an intracellular lectin in the early secretory pathway. LMAN2 interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. LMAN2 is also involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
MW :32.7kD.
Recombinant Human Vesicular Integral-Membrane Protein VIP36 is produced by our Mammalian expression system and the target gene encoding Asp45-Arg322 is expressed with a 6His tag at the C-terminus. Vesicular integral-membrane protein VIP36 is also known as Glycoprotein GP36b, Lectin mannose-binding 2, Vesicular integral-membrane protein 36, LMAN2 and C5orf8. LMAN2 is widely expressed and contains one L-type lectin-like domain. LMAN2 binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. LMAN2 plays a role as an intracellular lectin in the early secretory pathway. LMAN2 interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. LMAN2 is also involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum-Golgi intermediate compartment membrane, Golgi apparatus membrane, Endoplasmic reticulum membrane |
| Tissue Specificity: | Ubiquitous. |
| BioGrid: | 116159. 30 interactions. |
|
There are currently no product reviews
|








.png)












