Recombinant Human ZBTB17/Miz-1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.25. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MGSSHHHHHHSSGLVPRGSHMDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA |
MW :22.33kD.
Recombinant Human Zinc Finger and BTB Domain-Containing Protein 17 is produced by our E.coli expression system and the target gene encoding Met1-Ala188 is expressed with a 6His tag at the N-terminus. Zinc Finger and BTB Domain-Containing Protein 17 (ZBTB17) belongs to the Kruppel C2H2-type zinc finger protein family. ZBTB17 may function as a housekeeping DNA-binding protein that regulates the expression of specific genes, it has been shown to bind to the promoters of adenovirus major late protein and cyclin D1 and activate transcription. ZBTB17 may has growth arrest activity, probably through inhibition of cell cycle progression. ZBTB17 required for early embryonic development during gastrulation. ZBTB17 induces cell arrest at G1, an effect mediated by its activation of the gene coding for P15INK4b. This effect is blocked by Myc, which displaces transcriptional coactivators bound to ZBTB17. Although the downregulation of ZBTB17 may contribute to Myc-induced cell transformation, the de-activation of ZBTB17 is absolutely essential for Myc-induced apoptosis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Nucleus |
Tissue Specificity: | Expressed in germinal center B-cells. |
BioGrid: | 113503. 29 interactions. |
There are currently no product reviews
|