Recombinant Mouse C-X-C motif Chemokine 15/CXCL15/Lungkine (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDAVDHHHHHH |
Source: Human Cells.
MW :17.4kD.
Recombinant Mouse C-X-C motif chemokine 15 is produced by our Mammalian expression system and the target gene encoding Gln26-Ala167 is expressed with a 6His tag at the C-terminus. Mouse C-X-C motif chemokine 15, also known as Cxcl15, is a secreted protein which is member of the ELR motif-containing CXC chemokines. It expressed at low levels in fetal lung, the expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. It plays an important role in lung-specific neutrophil trafficking during normal and inflammatory conditions. It also appears chemotactic for neutrophils.
MW :17.4kD.
Recombinant Mouse C-X-C motif chemokine 15 is produced by our Mammalian expression system and the target gene encoding Gln26-Ala167 is expressed with a 6His tag at the C-terminus. Mouse C-X-C motif chemokine 15, also known as Cxcl15, is a secreted protein which is member of the ELR motif-containing CXC chemokines. It expressed at low levels in fetal lung, the expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. It plays an important role in lung-specific neutrophil trafficking during normal and inflammatory conditions. It also appears chemotactic for neutrophils.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. Expressed at low levels in fetal lung. |
|
There are currently no product reviews
|




















.png)










