Recombinant Mouse Complement Component C3a/C3a
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR |
Source: E.coli.
MW :9.2kD.
Recombinant Mouse Complement Component C3a is produced by our E.coli expression system and the target gene encoding Ser671-Arg748 is expressed. Complement is defined as key part of innate immunity and as the first line of defense in the fight against invading pathogens. Complement 3 (C3) is the most abundant component of the complement cascade and the convergent point for all three major complement activation pathways: namely classical, alternative and mannose-binding lectin pathways. Complement activation leads to the formation of the C3 convertase, which cleaves C3 into the key effector molecules, C3a (anaphylatoxin) and C3b (opsonin) which then drive microbe removal. By binding to C3a receptor (C3aR), C3a exhibits potent anaphylatoxin activity, including increased vascular permeability, triggering degranulation of mast cells, inflammation, and activating leukocytes.
MW :9.2kD.
Recombinant Mouse Complement Component C3a is produced by our E.coli expression system and the target gene encoding Ser671-Arg748 is expressed. Complement is defined as key part of innate immunity and as the first line of defense in the fight against invading pathogens. Complement 3 (C3) is the most abundant component of the complement cascade and the convergent point for all three major complement activation pathways: namely classical, alternative and mannose-binding lectin pathways. Complement activation leads to the formation of the C3 convertase, which cleaves C3 into the key effector molecules, C3a (anaphylatoxin) and C3b (opsonin) which then drive microbe removal. By binding to C3a receptor (C3aR), C3a exhibits potent anaphylatoxin activity, including increased vascular permeability, triggering degranulation of mast cells, inflammation, and activating leukocytes.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Phosphorylated by FAM20C in the extracellular medium. |
| BioGrid: | 198418. 1 interactions. |
|
There are currently no product reviews
|

















.png)









