Recombinant Mouse Complement Component C5(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 350mM NaCl, pH 7.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR |
Source: E.coli.
MW :9kD.
Recombinant Mouse Complement Component C5 is produced by our E.coli expression system and the target gene encoding Asn679-Arg755 is expressed. Mouse Complement C5 (C5a) is a glycoprotein that belongs to a family of structurally and functionally related proteins known as anaphylatoxins. C5a is a 77 amino acid peptide that is created by the C5a convertase proteolytic cleavage of C5 achain in the classical and alternative complement pathway (C4b2a3b, C3bBb3b). Mouse C5a has fourahelices, plus three intra-chain disulfide bonds that form a triple loop structure. C5a functions via G-protein coupled receptor (GPCR) (C5aR/CD88). C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. It mediates IL-8 release from bronchial epithelial cells. It also triggers an oxidative burst in macrophages and neutrophils, causing release of histamine in basophils and mast cells. C5a anaphylatoxin activity on hepatocytes results indirectly from interaction with nonparenchymal cell via prostanoid secretion. Mouse C5a shares 60% and 82% sequence identity to human and rat C5a, respectively.
MW :9kD.
Recombinant Mouse Complement Component C5 is produced by our E.coli expression system and the target gene encoding Asn679-Arg755 is expressed. Mouse Complement C5 (C5a) is a glycoprotein that belongs to a family of structurally and functionally related proteins known as anaphylatoxins. C5a is a 77 amino acid peptide that is created by the C5a convertase proteolytic cleavage of C5 achain in the classical and alternative complement pathway (C4b2a3b, C3bBb3b). Mouse C5a has fourahelices, plus three intra-chain disulfide bonds that form a triple loop structure. C5a functions via G-protein coupled receptor (GPCR) (C5aR/CD88). C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. It mediates IL-8 release from bronchial epithelial cells. It also triggers an oxidative burst in macrophages and neutrophils, causing release of histamine in basophils and mast cells. C5a anaphylatoxin activity on hepatocytes results indirectly from interaction with nonparenchymal cell via prostanoid secretion. Mouse C5a shares 60% and 82% sequence identity to human and rat C5a, respectively.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|
















.png)









