WISP1 Human(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 10 µg |
| Purification : | Greater than 95.0% as determined by SDS-PAGE. |
| Content : | WISP1 protein was lyophilized from a 0.2µm filtered solution in PBS. It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely. |
| Storage condition : | Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. |
| AA sequence : | TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRG LYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRR VSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCW PEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQC PDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFSEIANHHHHHHHHHH. |
| Alternative Name : | WNT1 Inducible Signaling Pathway Protein 1, CCN Family Member 4, CCN4, Wnt-1 Inducible, Signaling Pathway Protein 1, WNT1 Induced Secreted Protein 1, Wnt-1-Induced Secreted Protein, CTC-458A3.8, WISP1tc, WISP1c, WISP1i, WISP-1, WISP1. |
Source: HEK293 Cells.
Sterile Filtered White lyophilized (freeze-dried) powder.
WISP1 is a part of a family of cysteine-rich, glycosylated signaling proteins that mediate varied developmental processes. WISP1 is a Downstream regulator in the Wnt/Frizzled-signaling pathway and is linked with cell survival.WISP1weakens p53-mediated apoptosis in response to DNA damage through activation of AKT kinase and up-regulates the anti-apoptotic Bcl-X(L) protein.
WISP1 Human Recombinant produced in Mouse myeloma cell line is a single, glycosylated polypeptide chain containing 355 amino acids (Thr23- Asn367), having a molecular mass of 39.3kDa and fused to a 10 aa His Tag. The WISP1 is purified by proprietary chromatographic techniques.
Sterile Filtered White lyophilized (freeze-dried) powder.
WISP1 is a part of a family of cysteine-rich, glycosylated signaling proteins that mediate varied developmental processes. WISP1 is a Downstream regulator in the Wnt/Frizzled-signaling pathway and is linked with cell survival.WISP1weakens p53-mediated apoptosis in response to DNA damage through activation of AKT kinase and up-regulates the anti-apoptotic Bcl-X(L) protein.
WISP1 Human Recombinant produced in Mouse myeloma cell line is a single, glycosylated polypeptide chain containing 355 amino acids (Thr23- Asn367), having a molecular mass of 39.3kDa and fused to a 10 aa His Tag. The WISP1 is purified by proprietary chromatographic techniques.
|
There are currently no product reviews
|



















.png)











