Recombinant Mouse Cystatin E/CST6 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM MES,150mM NaCl,pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | ELRSRRTGERQNLSPTDPRVQKAAQAAVASYNMGSDSLYYFRDTKVIDAKYQLVAGIKYYLTLDIESTECRKTRVSGEHMDLTTCPLAAGGQQEKLRCNFELLEVPWKNTTQLLKHDCVQVVDHHHHHH |
Source: Human Cells.
MW :14.8kD.
Recombinant Mouse Cystatin E/M is produced by our Mammalian expression system and the target gene encoding Glu29-Val149 is expressed with a 6His tag at the C-terminus. Mouse CST6 is a member of the family 2 of the cystatin superfamily. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. CST6 is expressed in heart, liver and kidney. In addition to its function as a cysteine protease inhibitor, CST6 also serves as a target for cross-linking by transglutaminases. Accordingly, CST6 was suggested to be involved in barrier formation and maintenance. Furthermore, studies have revealed that CST6 is frequently epigenetically inactivated during breast carcinogenesis, and thus be regarded as a candidate of tumour suppressor gene.
MW :14.8kD.
Recombinant Mouse Cystatin E/M is produced by our Mammalian expression system and the target gene encoding Glu29-Val149 is expressed with a 6His tag at the C-terminus. Mouse CST6 is a member of the family 2 of the cystatin superfamily. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. CST6 is expressed in heart, liver and kidney. In addition to its function as a cysteine protease inhibitor, CST6 also serves as a target for cross-linking by transglutaminases. Accordingly, CST6 was suggested to be involved in barrier formation and maintenance. Furthermore, studies have revealed that CST6 is frequently epigenetically inactivated during breast carcinogenesis, and thus be regarded as a candidate of tumour suppressor gene.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|












.png)








