Recombinant Mouse GITR/TNFRSF18/CD357 (C-Fc-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Source: Human Cells.
MW :42.3kD.
Recombinant Mouse GITR is produced by our Mammalian expression system and the target gene encoding Ser22-His153 is expressed with a Fc, 6His tag at the C-terminus. Tumor necrosis factor receptor superfamily member 18(Gitr) contains 3 TNFR-Cys repeats and it have four isforms.IsformA?isformB and isformC is single-pass type I membrane protein and isformD is a secreted protein. The protein is the receptor for TNFSF18.It seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. It mediated NF-kappa-B activation via the TRAF2/NIK pathway.It binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 and binds through its C-terminus to SIVA1/SIVA.It preferentially expressed in activated T lymphocytes and up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.
MW :42.3kD.
Recombinant Mouse GITR is produced by our Mammalian expression system and the target gene encoding Ser22-His153 is expressed with a Fc, 6His tag at the C-terminus. Tumor necrosis factor receptor superfamily member 18(Gitr) contains 3 TNFR-Cys repeats and it have four isforms.IsformA?isformB and isformC is single-pass type I membrane protein and isformD is a secreted protein. The protein is the receptor for TNFSF18.It seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. It mediated NF-kappa-B activation via the TRAF2/NIK pathway.It binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 and binds through its C-terminus to SIVA1/SIVA.It preferentially expressed in activated T lymphocytes and up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Preferentially expressed in activated T lymphocytes. |
| BioGrid: | 204248. 1 interactions. |
|
There are currently no product reviews
|
















.png)










