Recombinant Mouse Host Cell Factor 2/HCFC2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of PBS,2MUrea,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MNHKVHHHHHHMAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE |
| Gene : | Hcfc2 |
| Uniprot ID : | Q9D968 |
Source: E.coli.
MW :55.2kD.
Recombinant Mouse Host cell factor 2 is produced by our E.coli expression system and the target gene encoding Met1-Glu497 is expressed with a 6His tag at the N-terminus. Host cell factor 2(HCFC2) is a cytoplasmic protein. It contains 2 fibronectin type-III domains.HCFC2 binds KMT2A/MLL1, as component of the MLL1/MLL complex.Hcfc2 negative regulation of transcription from RNA polymerase II promoter.
MW :55.2kD.
Recombinant Mouse Host cell factor 2 is produced by our E.coli expression system and the target gene encoding Met1-Glu497 is expressed with a 6His tag at the N-terminus. Host cell factor 2(HCFC2) is a cytoplasmic protein. It contains 2 fibronectin type-III domains.HCFC2 binds KMT2A/MLL1, as component of the MLL1/MLL complex.Hcfc2 negative regulation of transcription from RNA polymerase II promoter.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|











.png)








