Recombinant Mouse Interleukin-1 beta/IL-1 beta
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 50mM TrisHCl, 50mM NaCl, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
MW :17.4kD.
Recombinant Mouse Interleukin-1 beta is produced by our E.coli expression system and the target gene encoding Val118-Ser269 is expressed. Interleukin-1 (IL-1) designates two proteins, IL-1a and IL-1 beta, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1a and IL-1 beta are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1 beta, designated interleukin 1 beta-converting enzyme (ICE), has been described. Mature human and mouse IL-1 beta share approximately 75% amino acid sequence identity and human IL-1 beta has been found to be active on murine cell lines.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Biological Activity : ED50 is less than 0.01 ng/ml. Specific Activity of 1.0 x 10^8 IU/mg.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Rebekka I Stegmeyer, Malte Stasch, Daniel Olesker, Jonathan M Taylor, Thomas J Mitchell, Neveen A Hosny, Nils Kirschnick, Gunnar Spickermann, Dietmar Vestweber, Stefan Volkery.
Intravital Microscopy With an Airy Beam Light Sheet Microscope Improves Temporal Resolution and Reduces Surgical Trauma.
Microscopy and Microanalysis, 2024;, ozae099, https://doi.org/10.1093/mam/ozae099
| Subcellular location: | Cytoplasm, Lysosome, Secreted, Cytoplasmic vesicle, Secreted |
| Tissue Specificity: | Expressed in activated macrophages (at protein level). |
| BioGrid: | 200624. 6 interactions. |
|
There are currently no product reviews
|











.png)











