Recombinant Mouse Interleukin-11/IL-11 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :46.3kD.
Recombinant Mouse Interleukin-11 is produced by our Mammalian expression system and the target gene encoding Pro22-Leu199 is expressed with a Fc tag at the C-terminus. Interleukin-11(IL-11) is a secreted protein and belongs to the IL-6 superfamily. IL-11 has been demonstrated to improve platelet recovery after chemotherapy-induced thrombocytopenia, induceacute phase proteins, modulate antigen-antibody responses, participate in the regulation of bone cellproliferation and differentiation and could be use as a therapeutic for osteoporosis. IL-11 stimulates the growth of certain lymphocytes and, in the murine model, stimulates an increase in the cortical thickness and strength of long bones. In addition to having lymphopoietic/hematopoietic and osteotrophic properties, it has functions in many other tissues, including the brain, gut, testis and bone.
MW :46.3kD.
Recombinant Mouse Interleukin-11 is produced by our Mammalian expression system and the target gene encoding Pro22-Leu199 is expressed with a Fc tag at the C-terminus. Interleukin-11(IL-11) is a secreted protein and belongs to the IL-6 superfamily. IL-11 has been demonstrated to improve platelet recovery after chemotherapy-induced thrombocytopenia, induceacute phase proteins, modulate antigen-antibody responses, participate in the regulation of bone cellproliferation and differentiation and could be use as a therapeutic for osteoporosis. IL-11 stimulates the growth of certain lymphocytes and, in the murine model, stimulates an increase in the cortical thickness and strength of long bones. In addition to having lymphopoietic/hematopoietic and osteotrophic properties, it has functions in many other tissues, including the brain, gut, testis and bone.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|






















.png)












