Recombinant Mouse Neuroblastoma Suppressor of Tumorigenicity 1/NBL1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | APPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAEDVDHHHHHH |
Source: Human Cells.
MW :18.4kD.
Recombinant Mouse NBL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asp178 is expressed with a 6His tag at the C-terminus. Differential screening-selected gene aberrative in neuroblastoma (DAN) is a member of the DAN family of secreted glycoproteins. DAN family antagonists are characterized by a DAN domain that contains a cystine knot motif which is essential for binding to BMP ligands. Members of this family include DAN, gremlin, protein related to DAN and cerberus (PRDC), cerberus, sclerostin (SOST) and uterine sensitization-associated gene 1 protein, and control diverse processes in growth, development and the cell cycle. It has also been reported that DAN family plays crucial role in early mouse embryo development by inhibiting the action of bone morphogenic proteins and modulating the action of transforming growth factor- beta superfamily members. DAN is synthesized by small-to intermediate-sized DRG neurons and transported to the sensory nerve terminals in the skin or to the sensory nerve terminals in the dorsal horn. It has been reported that DAN is ubiquitously expressed in adult rat and human tissues. Morphological studies have revealed that, in adult rat, DAN mRNA is expressed ubiquitously in lung and brain, but not in liver.
MW :18.4kD.
Recombinant Mouse NBL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asp178 is expressed with a 6His tag at the C-terminus. Differential screening-selected gene aberrative in neuroblastoma (DAN) is a member of the DAN family of secreted glycoproteins. DAN family antagonists are characterized by a DAN domain that contains a cystine knot motif which is essential for binding to BMP ligands. Members of this family include DAN, gremlin, protein related to DAN and cerberus (PRDC), cerberus, sclerostin (SOST) and uterine sensitization-associated gene 1 protein, and control diverse processes in growth, development and the cell cycle. It has also been reported that DAN family plays crucial role in early mouse embryo development by inhibiting the action of bone morphogenic proteins and modulating the action of transforming growth factor- beta superfamily members. DAN is synthesized by small-to intermediate-sized DRG neurons and transported to the sensory nerve terminals in the skin or to the sensory nerve terminals in the dorsal horn. It has been reported that DAN is ubiquitously expressed in adult rat and human tissues. Morphological studies have revealed that, in adult rat, DAN mRNA is expressed ubiquitously in lung and brain, but not in liver.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|




















.png)











