Recombinant Mouse Nogo-66 Receptor/Reticulon 4 Receptor/NgR/RTN4R (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | CPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVASGPFRPIQTSQLTDEELLSLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDTPPGNGSGPRHINDSPFGTLPSSAEPPLTALRPGGSEPPGLPTTGPRRRPGCSRKNRTRSHCRLGQAGSGASGTGDAEGSVDHHHHHH |
Source: Human Cells.
MW :46.6kD.
Recombinant Mouse NgR is produced by our Mammalian expression system and the target gene encoding Cys27-Ser447 is expressed with a 6His tag at the C-terminus. Nogo Receptor (NgR) is a glycosylphosphoinositol (GPI)-anchored protein that belongs to the Nogo recptor family. Human NgR is predominantly expressed in neurons and their axons in the central nervous systems. As a receptor for myelin-derived proteins Nogo, myelin-associated glycoprotein (MAG) and myelin oligodendrocyte glycoprotein (OMG), NgR mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult central nervous system. NgR may be proposed as a potential drug target for treatment of various neurological conditions. Additionally, NgR may play a role in regulating the function of gap junctions.
MW :46.6kD.
Recombinant Mouse NgR is produced by our Mammalian expression system and the target gene encoding Cys27-Ser447 is expressed with a 6His tag at the C-terminus. Nogo Receptor (NgR) is a glycosylphosphoinositol (GPI)-anchored protein that belongs to the Nogo recptor family. Human NgR is predominantly expressed in neurons and their axons in the central nervous systems. As a receptor for myelin-derived proteins Nogo, myelin-associated glycoprotein (MAG) and myelin oligodendrocyte glycoprotein (OMG), NgR mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult central nervous system. NgR may be proposed as a potential drug target for treatment of various neurological conditions. Additionally, NgR may play a role in regulating the function of gap junctions.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Membrane raft, Cell projection, Cell projection, Perikaryon |
| Post transnational modification: | N-glycosylated. O-glycosylated. Contains terminal sialic acid groups on its glycan chains. |
| Tissue Specificity: | Detected in embryonic hippocampus neurons (PubMed:22325200). Detected in brain (at protein level) (PubMed:15504325, PubMed:22406547). Detected in neurons in the neocortex, in hippocampus, dorsal thalamus, cerebellum granule cell layer and the mitral cell layer in the olfactory bulb (PubMed:15647357). Detected in brain, dorsal root ganglion and heart. |
| BioGrid: | 211123. 1 interactions. |
|
There are currently no product reviews
|

















.png)











