Recombinant Mouse Plexin Domain-Containing Protein 2/PLXDC2 (C-6His)

Product code: 32-7645

Shipping Info:

Order now and get it on Thursday October 23, 2025

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $376.00 

  • $642.00 

Add to Wish List

Shipping Info:

Order now and get it on Thursday October 23, 2025

Same day delivery FREE on San Diego area orders placed by 1.00 PM


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : EPGHHTNDWIYEVTNAFPWNEEGVEVDSQAYNHRWKRNVDPFKAVDTNRASMGQASPESKGFTDLLLDDGQDNNTQIEEDTDHNYYISRIYGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATGGFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRTIYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEEVQSKEKMCEKTEPGETSQTTTTSHTTTMQFRVLTTTRRAVTSQMPTSLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHAVDHHHHHH
Gene : Plxdc2
Gene ID : 67448
Uniprot ID : Q9DC11

Source: Human Cells.
MW :48.95kD.
Recombinant Mouse PLXDC2 is produced by our Mammalian expression system and the target gene encoding Glu31-Ala455 is expressed with a 6His tag at the C-terminus. Mouse Plexin domain-containing protein 2(PLXDC2) is a single-pass type I membrane protein. The protein is expressed in tumor endothelium and in vessels of some normal tissues, such as the muscle and lung. PLXDC2 can interact with CTTN, and may play a role in tumor angiogenesis.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Membrane
Tissue Specificity: Expressed in tumor endothelium and in vessels of some normal tissues, such as the muscle and lung.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products