Recombinant Mouse Poliovirus Receptor/CD155/PVR/HVED (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLVDHHHHHH |
Source: Human Cells.
MW :35.8kD.
Recombinant Mouse Poliovirus Receptor is produced by our Mammalian expression system and the target gene encoding Asp29-Leu348 is expressed with a 6His tag at the C-terminus. CD155 is a type I transmembrane glycoprotein in the nectin-related family of adhesion proteins within the immunoglobulin superfamily. Mature mouse CD155 protein consists of one N-terminal V-type and two C2-type Ig-like domains. The V-type domain of CD155 mediates all binding and alternative splicing within this domain in humans can modulate ligand binding. CD155 binds molecules including Vitronectin, Nectin-3, DNAM-1/CD226, CD96, and TIGIT. CD155 is up-regulated on endothelial cells by IFN-gamma and is highly expressed on lymph node dendritic cells, immature thymocytes, and tumor cells of epithelial and neuronal origin. It is preferentially expressed on Th17 cells compared to Th2 cells, and its activation promotes the development of Th1 responses
MW :35.8kD.
Recombinant Mouse Poliovirus Receptor is produced by our Mammalian expression system and the target gene encoding Asp29-Leu348 is expressed with a 6His tag at the C-terminus. CD155 is a type I transmembrane glycoprotein in the nectin-related family of adhesion proteins within the immunoglobulin superfamily. Mature mouse CD155 protein consists of one N-terminal V-type and two C2-type Ig-like domains. The V-type domain of CD155 mediates all binding and alternative splicing within this domain in humans can modulate ligand binding. CD155 binds molecules including Vitronectin, Nectin-3, DNAM-1/CD226, CD96, and TIGIT. CD155 is up-regulated on endothelial cells by IFN-gamma and is highly expressed on lymph node dendritic cells, immature thymocytes, and tumor cells of epithelial and neuronal origin. It is preferentially expressed on Th17 cells compared to Th2 cells, and its activation promotes the development of Th1 responses
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|















.png)











