Recombinant Mouse Serpin F2/Alpha-2-Antiplasmin (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH 8.0(20% glycerol,1mM DTT). |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | VDLPGQQPVSEQAQQKLPLPALFKLDNQDFGDHATLKRSPGHCKSVPTAEETRRLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLANINQWVKEATEGKIEDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKNNMSFVVVMPTYFEWNVSEVLANLTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQGPDLRGISEQNLVVSSVQHQSTMELSEAGVEAAAATSVAMNRMSLSSFTVNRPFLFFIMEDTIGVPLFVGSVRNPNPSALPQLQEQRDSPDNRLIGQNDKADFHGGKTFGPDLKLAPRMEEDYPQFSSPKVDHHHHHH |
Source: Human Cells.
MW :53.2kD.
Recombinant Mouse Serpin F2 is produced by our Mammalian expression system and the target gene encoding Val28-Lys491 is expressed with a 6His tag at the C-terminus. Alpha-2-antiplasmin, also called Serpin F2, is a serine protease inhibitor (serpin) responsible for inactivating plasmin, and an important enzyme participates in fibrinolysis and degradation of other proteins. In liver cirrhosis, there is decreased production of alpha 2-antiplasmin, leading to decreased inactivation of plasmin and an increase in fibrinolysis. Serpin F2 is major expressed on liver and kidney. Some other tissues such as muscle, intestine, central nervous system, and placenta also express Serpin F2 mRNA at a moderate level indicated that it is a key regulator of plasmin-mediated proteolysis in these tissues.
MW :53.2kD.
Recombinant Mouse Serpin F2 is produced by our Mammalian expression system and the target gene encoding Val28-Lys491 is expressed with a 6His tag at the C-terminus. Alpha-2-antiplasmin, also called Serpin F2, is a serine protease inhibitor (serpin) responsible for inactivating plasmin, and an important enzyme participates in fibrinolysis and degradation of other proteins. In liver cirrhosis, there is decreased production of alpha 2-antiplasmin, leading to decreased inactivation of plasmin and an increase in fibrinolysis. Serpin F2 is major expressed on liver and kidney. Some other tissues such as muscle, intestine, central nervous system, and placenta also express Serpin F2 mRNA at a moderate level indicated that it is a key regulator of plasmin-mediated proteolysis in these tissues.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Proteolytically cleaved at Pro-35 by both the prolyl endopeptidase FAP form and antiplasmin-cleaving enzyme FAP soluble form to generate mature alpha-2-antiplasmin. |
| Tissue Specificity: | Expressed by the liver and secreted in plasma. |
|
There are currently no product reviews
|









.png)












