Recombinant Human Serpin Kazal-7/SPINK7/ECG2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSCVDHHHHHH |
Source: Human Cells.
MW :8.2kD.
Recombinant Human SPINK7 is produced by our Mammalian expression system and the target gene encoding Ser20-Cys85 is expressed with a 6His tag at the C-terminus. Serine protease inhibitor Kazal-type 7(SPINK7) is a secreted protein, that in humans is encoded by the SPINK7 gene. SPINK7 contains 1 Kazal-like domain. SPINK7 is probably serine protease inhibitor. Recombinant human SPINK7 is a single, non-glycosylated polypeptide chain containing 74 amino acids and fused to His-tag at c-terminus.
MW :8.2kD.
Recombinant Human SPINK7 is produced by our Mammalian expression system and the target gene encoding Ser20-Cys85 is expressed with a 6His tag at the C-terminus. Serine protease inhibitor Kazal-type 7(SPINK7) is a secreted protein, that in humans is encoded by the SPINK7 gene. SPINK7 contains 1 Kazal-like domain. SPINK7 is probably serine protease inhibitor. Recombinant human SPINK7 is a single, non-glycosylated polypeptide chain containing 74 amino acids and fused to His-tag at c-terminus.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 124174. 20 interactions. |
|
There are currently no product reviews
|











.png)








