Recombinant Mouse Transforming Growth Factor beta-2/TGF beta2/TGFB2
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 4 mM HCl. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS |
Source: Human Cells.
MW :12.7kD.
Recombinant Mouse Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed. Transforming growth factor beta 2 (TGF- beta2) is a member of TGF-beta superfamily that shares a characteristic cysteine knot structure. Mice with TGF- beta2 gene deletion show defects in development of cardiac, lung, craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF- beta isoforms signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
MW :12.7kD.
Recombinant Mouse Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed. Transforming growth factor beta 2 (TGF- beta2) is a member of TGF-beta superfamily that shares a characteristic cysteine knot structure. Mice with TGF- beta2 gene deletion show defects in development of cardiac, lung, craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF- beta isoforms signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. |
BioGrid: | 204160. 2 interactions. |
There are currently no product reviews
|