Recombinant PDGF Protein

Figure-1: SDS-PAGE analysis of purified Recombinant PDGF Protein was run on a 4-20% Gradient SDS-PAGE (Reducing) gel followed by Coomassie blue staining.
Roll over image to zoom in
Shipping Info:
Order now and get it on Thursday July 10, 2025
Same day delivery FREE on San Diego area orders placed by 1.00 PM
Amount : | 50 μg |
Content : | 50 mM Tris, pH-8.0, 150 mM NaCl, 10% Glycerol. |
Storage condition : | Store at – 20°C |
AA sequence : | MEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISR RLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEILEHHHHHH |
Source: E. coli. MW: ~16.2kDa.
There are currently no product reviews
|