Recombinant S. cerevisiae Translation Associated Element 1/TAE1/NTM1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MDVPADSHIKYEDAIDYWTDVDATVDGVLGGYGEGTVVPTMDVLGSNNFLRKLKSRMLPQENNVKYAVDIGAGIGRVSKTMLHKHAAKIDLVEPVKPFIEQMHVELAELKDKGQIGQIYEVGMQDWTPDAGKYWLIWCQWCVGHLPDAELVAFLKRCIVGLQPNGTIVVKENNTPTDTDDFDETDSSVTRSDAKFRQIFEEAGLKLIASERQRGLPRELYPVRMYALKPMPNLEHHHHHH |
Source: E.coli.
MW :27.13kD.
Recombinant S.cerevisiae Translation Associated Element 1 is produced by our E.coli expression system and the target gene encoding Met1-Asn232 is expressed with a 6His tag at the C-terminus. As the initiator Met is cleaved, Alpha N-methyltransferase melthylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys. In the alpha-amino group of Ala or Ser residue of [Ala-Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif, Alpha-N-methyltransferase catalyzes mono- , di- or tri-methylation. NTM1 is responsible for the N-terminal methylation of ribosomal protein, such as RPL12A, RPL12B, RPS25A, RPS25B.
MW :27.13kD.
Recombinant S.cerevisiae Translation Associated Element 1 is produced by our E.coli expression system and the target gene encoding Met1-Asn232 is expressed with a 6His tag at the C-terminus. As the initiator Met is cleaved, Alpha N-methyltransferase melthylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys. In the alpha-amino group of Ala or Ser residue of [Ala-Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif, Alpha-N-methyltransferase catalyzes mono- , di- or tri-methylation. NTM1 is responsible for the N-terminal methylation of ribosomal protein, such as RPL12A, RPL12B, RPS25A, RPS25B.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| BioGrid: | 32957. 109 interactions. |
|
There are currently no product reviews
|












.png)









