Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Immune-Check Point
    4. /
    5. mB7-H4 Stable Cell Line

    mB7-H4 Stable Cell Line

    Share:

    Fig-1: Detection of mouse B7-H4 in the CHO-K1/mB7-H4 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/mB7-H4 cells (Red).

    mB7-H4 Stable Cell Line

    Roll over image to zoom in

       

    Product code: 14-508ACL

    Application : Functional Assay

    Shipping Info:

    Order now and get it on Tuesday June 28, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Local delivery areas

    Same-day delivery in San Diego available for the following zip codes:

    92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
    Download TDS / Manual MSDS
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    1 Vial
    $2,750.00  $2,200.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    Order now and get it on Tuesday June 28, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Download TDS / Manual MSDS

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 1 Vial
    Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
    Storage condition : Immediately upon receipt, store in liquid nitrogen.

    mB7-H4 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses mouse B7-H4, also known as VTCN1.

    Sequence data: mB7-H4 (accession number NP_848709)

    MASLGQIIFWSIINIIIILAGAIALIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEP
    DIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNV
    QLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVA
    WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
    TDSEVKRRSQLQLLNSGPSPCVFSSAFVAGWALLSLSCCLMLR
     
     

    Application:.

    •  Screen for antibodies of mouse B7-H4 through Flow Cytometry. 

    Culture conditions:

    Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
     
    It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
     
    Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.
     
    To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
     
     
     

    LIMITED USE RESTRICTIONS:

    THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

    By use of this product, user agrees to be bound by the terms of this limited use statement.

    This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

    Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

     

     

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Recombinant Human Noggin/NOG (N-8His-Flag)(Discontinued)

    Recombinant Human Noggin/NOG (...

    details-Recombinant Human Noggin/NOG (N-8His-Flag)(Discontinued)
    Recombinant SARS-CoV-2 papain-like protease with His tag

    Recombinant SARS-CoV-2 papain-...

    details-Recombinant SARS-CoV-2 papain-like protease with His tag
    Monoclonal antibody to CD46 (Clone: TRA-2-10)

    Monoclonal antibody to CD46 (C...

    details-Monoclonal antibody to CD46 (Clone: TRA-2-10)
    Anti-Human CD172b Antibody (Clone : B4B6)

    Anti-Human CD172b Antibody (Cl...

    details-Anti-Human CD172b Antibody (Clone : B4B6)
    Monoclonal Antibody to human CD36

    Monoclonal Antibody to human C...

    details-Monoclonal Antibody to human CD36
    ACE2 Antibody (Alexa Fluor 750 Conjugated)

    ACE2 Antibody (Alexa Fluor 750...

    details-ACE2 Antibody (Alexa Fluor 750 Conjugated)
    CpG ODN (C274), TLR9 ligand (Class C)

    CpG ODN (C274), TLR9 ligand (C...

    details-CpG ODN (C274), TLR9 ligand (Class C)
    hB7-H4 Stable Cell Line

    hB7-H4 Stable Cell Line

    details-hB7-H4 Stable Cell Line
    Anti-GPRC5D antibody(DM61), Rabbit mAb

    Anti-GPRC5D antibody(DM61), Ra...

    details-Anti-GPRC5D antibody(DM61), Rabbit mAb
    SARS-CoV-2 Spike Protein S1 (RBD) Fc Tag

    SARS-CoV-2 Spike Protein S1 (R...

    details-SARS-CoV-2 Spike Protein S1 (RBD) Fc Tag
    Monoclonal Antibody to Rat CD43 (Clone:WEN3) FITC Conjugated

    Monoclonal Antibody to Rat CD4...

    details-Monoclonal Antibody to Rat CD43 (Clone:WEN3) FITC Conjugated
    TNF-alpha Leeporter™ Luciferase Reporter-HEK293 Cell Line

    TNF-alpha Leeporter™ Lucifer...

    details-TNF-alpha Leeporter™ Luciferase Reporter-HEK293 Cell Line
    Anti-Mouse CD2 Antibody (Clone : RM2-5)

    Anti-Mouse CD2 Antibody (Clone...

    details-Anti-Mouse CD2 Antibody (Clone : RM2-5)
    Anti-Estrogen Receptor Monoclonal Antibody (Clone:IHC403)-Ready to Use

    Anti-Estrogen Receptor Monoclo...

    details-Anti-Estrogen Receptor Monoclonal Antibody (Clone:IHC403)-Ready to Use

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    PD-L2 Stable Cell Line

    PD-L2 Stable Cell Line

    Mouse PD-L1 Pre-Coated ELISA Kit

    Mouse PD-L1 Pre-Coated ELISA Kit

    Monoclonal Antibody to CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker)(Clone : SPM609)

    Monoclonal Antibody to CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker)(Clone : SPM609)

    New Products

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    close

    Please Login to write a Review !!


    close

    mB7-H4 Stable Cell Line

    Product code: 14-508ACL
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart