Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Antibodies
    4. /
    5. Cancer Marker
    6. /
    7. Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)

    Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)

    Share:

    Formalin-fixed, paraffin-embedded human GIST stained with DOG1 Monoclonal Antibody (DG1/447 + DOG1.1).

    Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)

    Roll over image to zoom in

       

    Product code: 36-1582

    Clone name : DG1/447 + DOG-1.1
    Clonality : Monoclonal
    Application : IHC
    Reactivity : Human

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS MSDS
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    100 µg
    $499.00  $399.20 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS MSDS

    • Product Info
    • Antigen Details
    • Description
    • Application Note
    • More
    • Review   (0)
    Format : Purified
    Amount : 100 µg
    Isotype : Mouse IgG1, kappa + Mouse IgG1, kappa
    Purification : Affinity Chromatography
    Content : 100 µg in 500 µl PBS containing 0.05% BSA and 0.05% sodium azide. Sodium azide is highly toxic.
    Storage condition : Store the antibody at 4°C; stable for 6 months. For long-term storage; store at -20°C. Avoid repeated freeze and thaw cycles.
    Gene : ANO1
    Gene ID : 55107
    Uniprot ID : Q5XXA6
    Alternative Name : ANO1, DOG1, ORAOV2, TAOS2, TMEM16A
    Immunogen Information : Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjµgated to a carrier protein (DOG-1.1).

    Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.

    Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes);

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    Subcellular location: Cell membrane, Cytoplasm
    Tissue Specificity: Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles.
    BioGrid: 120417. 1 interactions.
    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Anti-Human CD230 / Prion Antibody (Clone : EM-21)

    Anti-Human CD230 / Prion Antib...

    details-Anti-Human CD230 / Prion Antibody (Clone : EM-21)
    Polyclonal Antibody to GSK3 Alpha/beta(Phospho-Tyr279/216)

    Polyclonal Antibody to GSK3 Al...

    details-Polyclonal Antibody to GSK3 Alpha/beta(Phospho-Tyr279/216)
    Anti-HSP60 Monoclonal Antibody (Clone : LK1) ATTO 594

    Anti-HSP60 Monoclonal Antibody...

    details-Anti-HSP60 Monoclonal Antibody (Clone : LK1) ATTO 594
    gAcrp30 His Recombinant Protein

    gAcrp30 His Recombinant Protei...

    details-gAcrp30 His Recombinant Protein
    Anti-HLA-F Antibody (Clone : 3D11)

    Anti-HLA-F Antibody (Clone : 3...

    details-Anti-HLA-F Antibody (Clone : 3D11)
    Fibronectin Native Protein

    Fibronectin Native Protein

    details-Fibronectin Native Protein
    Mouse IgG2b Isotype Control DyLight<sup>®</sup> 650 (Clone : MPC-11)

    Mouse IgG2b Isotype Control Dy...

    details-Mouse IgG2b Isotype Control DyLight<sup>®</sup> 650 (Clone : MPC-11)
    Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) APC(Discontinued)

    Anti-HSP90 beta Monoclonal Ant...

    details-Anti-HSP90 beta Monoclonal Antibody (Clone : Hyb-K3701) APC(Discontinued)
    Anti-HLA-ABCE PE (Clone : TP25.99SF)

    Anti-HLA-ABCE PE (Clone : TP25...

    details-Anti-HLA-ABCE PE (Clone : TP25.99SF)
    Anti-CD81 Monoclonal Antibody (Clone:M38)-Low Endotoxin

    Anti-CD81 Monoclonal Antibody ...

    details-Anti-CD81 Monoclonal Antibody (Clone:M38)-Low Endotoxin
    mC19ORF80 Recombinant Protein

    mC19ORF80 Recombinant Protein

    details-mC19ORF80 Recombinant Protein
    Recombinant Human Proliferating Cell Antigen, S9

    Recombinant Human Proliferatin...

    details-Recombinant Human Proliferating Cell Antigen, S9
    Anti-Human CD11a (Efalizumab) – Biotin

    Anti-Human CD11a (Efalizumab) ...

    details-Anti-Human CD11a (Efalizumab) – Biotin
    Anti-Human CD164 Antibody (Clone : 67D2)

    Anti-Human CD164 Antibody (Clo...

    details-Anti-Human CD164 Antibody (Clone : 67D2)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Biotin Conjugated, Anti-Cytokeratin 18 Monoclonal Antibody (Clone:DA-7)

    Biotin Conjugated, Anti-Cytokeratin 18 Monoclonal Antibody (Clone:DA-7)

    Anti-Cytokeratin, pan (Epithelial Marker) Monoclonal Antibody(Clone: AE-1/AE-3)-FITC

    Anti-Cytokeratin, pan (Epithelial Marker) Monoclonal Antibody(Clone: AE-1/AE-3)-FITC

    Mouse Monoclonal Antibody to CK18 (CK-LMW)(Clone :BS83)(Discontinued)

    Mouse Monoclonal Antibody to CK18 (CK-LMW)(Clone :BS83)(Discontinued)

    close

    Please Login to write a Review !!


    close

    Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)

    Product code: 36-1582
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart