Anti-FABP4 Polyclonal Antibody
Figure 1: Anti-FABP4 antibody(39-2008). Western blotting : Lanes: Anti FABP4(39-2008) at 0.5ug/ml, Lane 1: Rat Thymus Tissue Lysate at 50ug, Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug, Lane 3: Mouse Thymus Tissue Lysate at 50ug, Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug.Predicted band size: 15 kDa. Observed band size: 15 kDa.
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Format : | Lyophilized |
Amount : | 100 μg/vial |
Isotype : | Rabbit IgG |
Purification : | Immunogen affinity purified. |
Content : | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. Reconstitute : Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Storage condition : | At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing. |
Gene : | FABP4 |
Gene ID : | 2167 |
Uniprot ID : | P15090 |
Alternative Name : | Fatty acid-binding protein, adipocyte; Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4; FABP4 |
Immunogen Information : | A synthetic peptide corresponding to a sequence at the N-terminus of Human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related Mouse and Rat sequences. |
Western blot : 0.1-0.5μg/ml; Immunohistochemistry(Paraffin-embedded Section) : 0.5-1μg/ml
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cytoplasm, Nucleus |
BioGrid: | 108465. 14 interactions. |
There are currently no product reviews
|