Recombinant Human a-Amylase 2B/AMY2B (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH |
Source: Human Cells.
MW :56.9kD.
Recombinant Human alpha-amylase 2B is produced by our Mammalian expression system and the target gene encoding Gln16-Leu511 is expressed with a 6His tag at the C-terminus. Alpha-amylase 2B is an enzyme that in humans is encoded by the AMY2B gene. Alpha-amylase 2B is a secreted protein and belongs to the glycosyl hydrolase 13 family. It hydrolyzes 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. Diseases associated with AMY2B include pancreatitis, and thyroiditis, and among its related super-pathways are Metabolic pathways and MPS IIIC - Sanfilippo syndrome C.
MW :56.9kD.
Recombinant Human alpha-amylase 2B is produced by our Mammalian expression system and the target gene encoding Gln16-Leu511 is expressed with a 6His tag at the C-terminus. Alpha-amylase 2B is an enzyme that in humans is encoded by the AMY2B gene. Alpha-amylase 2B is a secreted protein and belongs to the glycosyl hydrolase 13 family. It hydrolyzes 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. Diseases associated with AMY2B include pancreatitis, and thyroiditis, and among its related super-pathways are Metabolic pathways and MPS IIIC - Sanfilippo syndrome C.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 106777. 2 interactions. |
|
There are currently no product reviews
|














.png)










