Recombinant Human BAX/Bcl-2-Like Protein 4/BCL2L4 (N, C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH |
Source: E. coli.
MW :22.1kD.
Recombinant Human BCL2-associated X protein is produced by our E.coli expression system and the target gene encoding Met1-Gln171 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Apoptosis Regulator BAX (BAX) belongs to the Bcl-2 family. BAX exists as a homodimer and is expressed in a wide variety of tissues. The Bax gene encodes different isoforms including Bax alpha (21 kDa) and Bax beta (24 kDa). Although both isoforms contain BH1, BH2 and BH3 domains, Bax beta has a unique carboxyl terminus and does not contain a hydrophobic transmembrane domain. BAX accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. BAX also promotes activation of CASP3, and thereby apoptosis.
MW :22.1kD.
Recombinant Human BCL2-associated X protein is produced by our E.coli expression system and the target gene encoding Met1-Gln171 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Apoptosis Regulator BAX (BAX) belongs to the Bcl-2 family. BAX exists as a homodimer and is expressed in a wide variety of tissues. The Bax gene encodes different isoforms including Bax alpha (21 kDa) and Bax beta (24 kDa). Although both isoforms contain BH1, BH2 and BH3 domains, Bax beta has a unique carboxyl terminus and does not contain a hydrophobic transmembrane domain. BAX accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. BAX also promotes activation of CASP3, and thereby apoptosis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| BioGrid: | 107057. 78 interactions. |
|
There are currently no product reviews
|














.png)











