Recombinant Human BCAS2/DAM1 (C-6His, N-T7 tag)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 200mM NaCl, 2mM DTT, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MASMTGGQQMGRGSMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDFLEHHHHHH |
Source: E.coli.
MW :28.58kD.
Recombinant Human BCAS2 is produced by our E.coli expression system and the target gene encoding Ala2-Phe225 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus. Breast Carcinoma-Amplified Sequence 2 (BCAS2) is a member of the SPF27 family. BCAS2 is a nuclear protein and widely expressed in many rtissues. BCAS2 is identified as being overexpressed in various breast cancer cell lines. BCAS2 is a component of the spliceosome, taking part in the removal of introns from mRNA precursors. BCAS2 interacts with estrogen receptor alpha and beta, thyroid hormone receptor beta, peroxisome proliferator-activated receptor gamma. BCAS2 functions as an ER co-activator and is capable of enhancing ER-mediated transcription.
MW :28.58kD.
Recombinant Human BCAS2 is produced by our E.coli expression system and the target gene encoding Ala2-Phe225 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus. Breast Carcinoma-Amplified Sequence 2 (BCAS2) is a member of the SPF27 family. BCAS2 is a nuclear protein and widely expressed in many rtissues. BCAS2 is identified as being overexpressed in various breast cancer cell lines. BCAS2 is a component of the spliceosome, taking part in the removal of introns from mRNA precursors. BCAS2 interacts with estrogen receptor alpha and beta, thyroid hormone receptor beta, peroxisome proliferator-activated receptor gamma. BCAS2 functions as an ER co-activator and is capable of enhancing ER-mediated transcription.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| Tissue Specificity: | Ubiquitously expressed. |
| BioGrid: | 115575. 110 interactions. |
|
There are currently no product reviews
|















.png)










