Recombinant Human beta-Nerve Growth Factor/ beta-NGF (Ser122-Ala241, E. coli)

Product code: 32-7050

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $324.00 

  • $420.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 250mM NaCl, pH 7.0.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Gene : NGF
Gene ID : 4803
Uniprot ID : P01138
Source: E.coli.
MW :13.4kD.
Recombinant Human beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Ser122-Ala241 is expressed. Human beta-Nerve Growth Factor ( beta-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits a, beta, and gamma; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. B-NGF is a neurotrophic factor that signals through its receptor beta-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. B-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Biological Activity : ED50 is less than 1.0 ng/ml. Specific Activity is greater than 1 x 10^6 IU/mg.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
BioGrid: 110869. 6 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products