Recombinant Human Brain Natriuretic Peptide/BNP (His27-His134, N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Source: E.coli.
MW :14.2kD.
Recombinant Human Natriuretic Peptides B is produced by our E.coli expression system and the target gene encoding His27-His134 is expressed with a 6His tag at the N-terminus. Human Natriuretic peptides B acts as a cardiac hormone; it is associated with many biological actions, such as diuresis, natriuresis, vasorelaxation, which inhibits the secretion of rennin and aldosterone. It acts as a paracrine antifibrotic factor in the heart. Natriuretic peptides B can help restore the body balance of salt and water, improves the heart function. Natriuretic peptides B binds and stimulates the cGMP production of the NPR1 receptor and binds the clearance receptor NPR3.
MW :14.2kD.
Recombinant Human Natriuretic Peptides B is produced by our E.coli expression system and the target gene encoding His27-His134 is expressed with a 6His tag at the N-terminus. Human Natriuretic peptides B acts as a cardiac hormone; it is associated with many biological actions, such as diuresis, natriuresis, vasorelaxation, which inhibits the secretion of rennin and aldosterone. It acts as a paracrine antifibrotic factor in the heart. Natriuretic peptides B can help restore the body balance of salt and water, improves the heart function. Natriuretic peptides B binds and stimulates the cGMP production of the NPR1 receptor and binds the clearance receptor NPR3.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The brain natriuretic peptide 32 form is cleaved at Pro-104 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
| Tissue Specificity: | Brain and also in atria, but at much lower levels than ANP. |
| BioGrid: | 110939. 19 interactions. |
|
There are currently no product reviews
|









.png)











