Recombinant Human cAMP-dependent Protein Kinase Inhibitor beta/PKI- beta (N-6His)

Product code: 32-7225

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $420.00 

  • $699.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 20% Glycerol, pH 8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
Gene : PKIB
Gene ID : 5570
Uniprot ID : Q9C010
Source: E.coli.
MW :10.6kD.
Recombinant Human PKI-beta is produced by our E.coli expression system and the target gene encoding Met1-Lys78 is expressed with a 6His tag at the N-terminus. cAMP-Dependent Protein Kinase Inhibitor beta (PKI- beta) is a member of the PKI family. It has been shown that PKI- beta is an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity; this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

BioGrid: 111557. 5 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products