Recombinant Human Vitamin D-Binding Protein/VDB/Gc-globulin (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNILVDHHHHHH |
Source: Human Cells.
MW :52.3kD.
Recombinant Human Vitamin D-Binding Protein is produced by our Mammalian expression system and the target gene encoding Leu17-Leu474 is expressed with a 6His tag at the C-terminus. Vitamin D-Binding Protein (DBP) is a member of the ALB/AFP/VDB family. DBP is a secreted protein and contains three albumin domains. The primary structure contains 28 cysteine residues forming multiple disulfide bonds. DBP acts as a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. DBP binds to vitamin D and its plasma metabolites and transports them to target tissues. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes.
MW :52.3kD.
Recombinant Human Vitamin D-Binding Protein is produced by our Mammalian expression system and the target gene encoding Leu17-Leu474 is expressed with a 6His tag at the C-terminus. Vitamin D-Binding Protein (DBP) is a member of the ALB/AFP/VDB family. DBP is a secreted protein and contains three albumin domains. The primary structure contains 28 cysteine residues forming multiple disulfide bonds. DBP acts as a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. DBP binds to vitamin D and its plasma metabolites and transports them to target tissues. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Allele GC*1S is O-glycosylated at Thr-436 (PubMed:20079467). The trisaccharide sugar moiety can be modified by the successive removal of neuraminic acid and galactose leaving an O-linked N-acetyl-galactosamine. This conversion is thought to produce a macrophage-activating factor (Gc-MAF). Only a minor proportion of plasma GC is O-glycosylated (PubMed:17360250). The potential N-glycosylation site predicted at Asn-288 is thought to be nonglycosylated. |
| Tissue Specificity: | Expressed in the liver. Found in plasma, ascites, cerebrospinal fluid and urine. |
| BioGrid: | 108908. 22 interactions. |
|
There are currently no product reviews
|
















.png)






