Recombinant Human Death Receptor 3/DR3/TNFRSF25 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :46.3kD.
Recombinant Human Death Receptor 3 is produced by our Mammalian expression system and the target gene encoding Gln25-Phe201 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) contains 1 death domain and 4 TNFR-Cys repeats. TNFRSF25 is a cell surface receptor of the tumor necrosis factor receptor superfamily which mediates apoptotic signalling and differentiation, activated by a monogamous ligand, known as TL1A (TNFSF15), which is rapidly upregulated in antigen presenting cells and some endothelial cells following Toll-Like Receptor or Fc receptor activation. This receptor has been shown to signal both through the TRADD adaptor molecule to stimulate NF-kappa B activity or through the FADD adaptor molecule to stimulate caspase activation and regulate cell apoptosis. It may play a role in regulating lymphocyte homeostasis.
MW :46.3kD.
Recombinant Human Death Receptor 3 is produced by our Mammalian expression system and the target gene encoding Gln25-Phe201 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) contains 1 death domain and 4 TNFR-Cys repeats. TNFRSF25 is a cell surface receptor of the tumor necrosis factor receptor superfamily which mediates apoptotic signalling and differentiation, activated by a monogamous ligand, known as TL1A (TNFSF15), which is rapidly upregulated in antigen presenting cells and some endothelial cells following Toll-Like Receptor or Fc receptor activation. This receptor has been shown to signal both through the TRADD adaptor molecule to stimulate NF-kappa B activity or through the FADD adaptor molecule to stimulate caspase activation and regulate cell apoptosis. It may play a role in regulating lymphocyte homeostasis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Glycosylated. |
| Tissue Specificity: | Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate. |
| BioGrid: | 114258. 11 interactions. |
|
There are currently no product reviews
|

















.png)











