Recombinant Human Galectin-3/LGALS3 (C-6His, Human Cells)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4, 3mM DTT. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIVDHHHHHH |
Source: Human Cells.
MW :27.2kD.
Recombinant Human Galectin-3 is produced by our Mammalian expression system and the target gene encoding Ala2-Ile250 is expressed with a 6His tag at the C-terminus. Galectin-3(LGALS3) is also known as Galactose-specific lectin 3, Mac-2 antigen, Carbohydrate-binding protein 35, Laminin-binding protein and Galactoside-binding protein. LGALS3 is highly expressed in early stages of papillary carcinoma, and lowly during tumor progression. LGALS3 is probably forms homo- or heterodimers and secreted by a non-classical secretory pathway and associates with the cell surface. LGALS3 plays an important role during the acquisition of vasculogenic mimicry and angiogenic properties. LGLAS3 takes part in an immune regulator to inhibit T-cell immune responses and promote tumor growth, as a result providing a new mechanism for tumor immune tolerance.
MW :27.2kD.
Recombinant Human Galectin-3 is produced by our Mammalian expression system and the target gene encoding Ala2-Ile250 is expressed with a 6His tag at the C-terminus. Galectin-3(LGALS3) is also known as Galactose-specific lectin 3, Mac-2 antigen, Carbohydrate-binding protein 35, Laminin-binding protein and Galactoside-binding protein. LGALS3 is highly expressed in early stages of papillary carcinoma, and lowly during tumor progression. LGALS3 is probably forms homo- or heterodimers and secreted by a non-classical secretory pathway and associates with the cell surface. LGALS3 plays an important role during the acquisition of vasculogenic mimicry and angiogenic properties. LGLAS3 takes part in an immune regulator to inhibit T-cell immune responses and promote tumor growth, as a result providing a new mechanism for tumor immune tolerance.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Secreted |
| Tissue Specificity: | A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes. |
| BioGrid: | 110149. 214 interactions. |
|
There are currently no product reviews
|

















.png)







