Recombinant Mouse Pulmonary Surfactant-associated Protein D/SP-D (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEFVDHHHHHH |
Source: Human Cells.
MW :36.7kD.
Recombinant Mouse Pulmonary Surfactant-associated Protein D is produced by our Mammalian expression system and the target gene encoding Ala20-Phe374 is expressed with a 6His tag at the C-terminus. SP-D (surfactant protein-D) is a 43 kDa member of the collectin family of innate immune modulators. Mouse SP-D cDNA encodes a 19 aa signal sequence and a 355 aa mature region with a 25 aa N-terminal linking-region, a 177 aa hydroxyproline and hydroxylysine collagen-like domain, a 46 aa coiled-coil segment, and a 106 aa, C-terminal collectin-like C-type lectin domain .SP-D is usually found as a glycosylated, disulfide-linked 150 kDa alpha -helical coiled-coil trimer with a “head” of three symmetrical CRDs . SP-D also binds SIRP alpha and the calreticulin/CD91 complex on macrophages.
MW :36.7kD.
Recombinant Mouse Pulmonary Surfactant-associated Protein D is produced by our Mammalian expression system and the target gene encoding Ala20-Phe374 is expressed with a 6His tag at the C-terminus. SP-D (surfactant protein-D) is a 43 kDa member of the collectin family of innate immune modulators. Mouse SP-D cDNA encodes a 19 aa signal sequence and a 355 aa mature region with a 25 aa N-terminal linking-region, a 177 aa hydroxyproline and hydroxylysine collagen-like domain, a 46 aa coiled-coil segment, and a 106 aa, C-terminal collectin-like C-type lectin domain .SP-D is usually found as a glycosylated, disulfide-linked 150 kDa alpha -helical coiled-coil trimer with a “head” of three symmetrical CRDs . SP-D also binds SIRP alpha and the calreticulin/CD91 complex on macrophages.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Secreted |
| Post transnational modification: | S-nitrosylation at Cys-34 and Cys-39 alters the quaternary structure which results in a pro-inflammatory chemoattractive signaling activity with macrophages. |
| BioGrid: | 203194. 2 interactions. |
|
There are currently no product reviews
|


















.png)











