Recombinant Human gamma-Glutamylaminecyclotransferase/GGACT (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR |
Source: E.coli.
MW :19.5kD.
Recombinant Human gamma-Glutamylaminecyclotransferase is produced by our E.coli expression system and the target gene encoding Met1-Arg153 is expressed with a 6His tag at the N-terminus. Gamma-Glutamylaminecyclotransferase is an enzyme that converts gamma-glutamylamines to free amines and 5-oxoproline which belongs to the gamma-glutamylcyclotransferase family. It shows high activity toward gamma-glutamyl-epsilon-lysine, derived from the breakdown of fibrin and contributes to degradation of proteins cross-linked by transglutaminases. It degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. This protein adopts the newly identified cyclotransferase fold, observed in Gamma-Glutamylcyclotransferase, an enzyme with activity toward gamma-glutamyl-alpha-amino acids.
MW :19.5kD.
Recombinant Human gamma-Glutamylaminecyclotransferase is produced by our E.coli expression system and the target gene encoding Met1-Arg153 is expressed with a 6His tag at the N-terminus. Gamma-Glutamylaminecyclotransferase is an enzyme that converts gamma-glutamylamines to free amines and 5-oxoproline which belongs to the gamma-glutamylcyclotransferase family. It shows high activity toward gamma-glutamyl-epsilon-lysine, derived from the breakdown of fibrin and contributes to degradation of proteins cross-linked by transglutaminases. It degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. This protein adopts the newly identified cyclotransferase fold, observed in Gamma-Glutamylcyclotransferase, an enzyme with activity toward gamma-glutamyl-alpha-amino acids.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 124581. 2 interactions. |
|
There are currently no product reviews
|












.png)







