Recombinant Human GDNF Receptor a-2/GFRA2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSVDHHHHHH |
Source: Human Cells.
MW :47.79kD.
Recombinant Human GDNF Family Receptor alpha-2 is produced by our Mammalian expression system and the target gene encoding Ser22-Ser441 is expressed with a 6His tag at the C-terminus. Members of the glial cell line-derived neurotrophic factor (GDNF) family, including GDNF and Neurturin, play key roles in the control of vertebrate neuronal survivial and differentiation. GDNF is a glycosylated, disulfide-bonded homodimer that is distantly related to the TGF superfamily of growth factors. Three receptors for these factors, GFRa-1, GFRa-2, and GFRa-3 have been identified. The receptors do not contain transmembrane domains and are attached to the cell membrane by glycosyl-phosphoinositol linkage. Both GFRa-1 and GFRa-2 have been shown to mediate the GDNF-dependent and Neurturin-dependent phosphorylation and activation of the tyrosine kinase Ret. GFR-3 is expressed only during development. GFRa-2 binds Neurturin and mediates activation of RET receptor tyrosine kinase by both Neurturin and GDNF.
MW :47.79kD.
Recombinant Human GDNF Family Receptor alpha-2 is produced by our Mammalian expression system and the target gene encoding Ser22-Ser441 is expressed with a 6His tag at the C-terminus. Members of the glial cell line-derived neurotrophic factor (GDNF) family, including GDNF and Neurturin, play key roles in the control of vertebrate neuronal survivial and differentiation. GDNF is a glycosylated, disulfide-bonded homodimer that is distantly related to the TGF superfamily of growth factors. Three receptors for these factors, GFRa-1, GFRa-2, and GFRa-3 have been identified. The receptors do not contain transmembrane domains and are attached to the cell membrane by glycosyl-phosphoinositol linkage. Both GFRa-1 and GFRa-2 have been shown to mediate the GDNF-dependent and Neurturin-dependent phosphorylation and activation of the tyrosine kinase Ret. GFR-3 is expressed only during development. GFRa-2 binds Neurturin and mediates activation of RET receptor tyrosine kinase by both Neurturin and GDNF.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Isoform 1 is found in both brain and placenta. |
| BioGrid: | 108943. 3 interactions. |
|
There are currently no product reviews
|











.png)








