Recombinant Human Glioma Pathogenesis-Related Protein 1/GLIPR1/RTVP1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRVDHHHHHH |
Source: Human Cells.
MW :25.16kD.
Recombinant Human GLIPR1 is produced by our Mammalian expression system and the target gene encoding Asn22-Arg232 is expressed with a 6His tag at the C-terminus. Glioma Pathogenesis-Related Protein 1 (GLIPR1) is a member of the CRISP family. It is a single-pass membrane protein with 266 amino acids. GLIPR1 is highly expressed in the lung and kidney and lowly expressed in the heart and liver. It is also highly expressed in cell lines that are derived from nervous system tumors arising from glia; conversely, it is lowly expressed in non-glial-derived nervous system tumor cell lines. GLIPR1 is only expressed in brain tumor glioblastoma multiforme/astrocytoma and not expressed in other nervous system tumors nor normal adult or fetal tissues.
MW :25.16kD.
Recombinant Human GLIPR1 is produced by our Mammalian expression system and the target gene encoding Asn22-Arg232 is expressed with a 6His tag at the C-terminus. Glioma Pathogenesis-Related Protein 1 (GLIPR1) is a member of the CRISP family. It is a single-pass membrane protein with 266 amino acids. GLIPR1 is highly expressed in the lung and kidney and lowly expressed in the heart and liver. It is also highly expressed in cell lines that are derived from nervous system tumors arising from glia; conversely, it is lowly expressed in non-glial-derived nervous system tumor cell lines. GLIPR1 is only expressed in brain tumor glioblastoma multiforme/astrocytoma and not expressed in other nervous system tumors nor normal adult or fetal tissues.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-glial-derived nervous system tumor cell lines. Also found in fetal kidney. According to PubMed:7607567 it is expressed only in brain tumor glioblastoma multiforme/astrocytoma and not in other nervous system tumors or normal fetal or adult tissues. |
| BioGrid: | 116200. 8 interactions. |
|
There are currently no product reviews
|












.png)








