Recombinant Human Granzyme A/GZMA (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM MES, 150mM NaCl, pH 5.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVVDHHHHHH |
Source: Human Cells.
MW :27.11kD.
Recombinant Human Granzyme A is produced by our Mammalian expression system and the target gene encoding Glu27-Val262 is expressed with a 6His tag at the C-terminus. Granzyme A is a member of the Franzyme family. Granzyme A is the most abundant Serine Protease in Cytotoxic T Lymphocytes (CTL) and Natural Killer (NK) cells. Granzyme A has a specifically function in CTL and NK cells. It induces caspase-independent cell death when introduced into target cells by perforin. Human Granzyme A is synthesized as a precursor (262 residues) with a signal peptide (residues 1-26), a propeptide (residues 27-28) and a mature chain (residues 29-262).
MW :27.11kD.
Recombinant Human Granzyme A is produced by our Mammalian expression system and the target gene encoding Glu27-Val262 is expressed with a 6His tag at the C-terminus. Granzyme A is a member of the Franzyme family. Granzyme A is the most abundant Serine Protease in Cytotoxic T Lymphocytes (CTL) and Natural Killer (NK) cells. Granzyme A has a specifically function in CTL and NK cells. It induces caspase-independent cell death when introduced into target cells by perforin. Human Granzyme A is synthesized as a precursor (262 residues) with a signal peptide (residues 1-26), a propeptide (residues 27-28) and a mature chain (residues 29-262).
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Cytoplasmic granule |
| BioGrid: | 109256. 17 interactions. |
|
There are currently no product reviews
|















.png)








