Recombinant Human Hematopoietic Lineage Cell-Specific Protein/HCLS1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAVDHHHHHHGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE |
Source: Human Cells.
MW :55kD.
Recombinant Human Hematopoietic lineage cell-specific protein is produced by our Mammalian expression system and the target gene encoding Met1-Glu486 is expressed with a 6His tag at the C-terminus. Hematopoietic lineage cell-specific protein (HCLS1) is a protein that in humans is encoded by the HCLS1 gene. It is expressed only in tissues and cells of hematopoietic origin. It is substrate of the antigen receptor-coupled tyrosine kinase and plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. It may also be involved in the regulation of gene expression.
MW :55kD.
Recombinant Human Hematopoietic lineage cell-specific protein is produced by our Mammalian expression system and the target gene encoding Met1-Glu486 is expressed with a 6His tag at the C-terminus. Hematopoietic lineage cell-specific protein (HCLS1) is a protein that in humans is encoded by the HCLS1 gene. It is expressed only in tissues and cells of hematopoietic origin. It is substrate of the antigen receptor-coupled tyrosine kinase and plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. It may also be involved in the regulation of gene expression.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane, Cytoplasm, Mitochondrion |
| Post transnational modification: | Phosphorylated by FES (By similarity). Phosphorylated by LYN, FYN and FGR after cross-linking of surface IgM on B-cells. Phosphorylation by LYN, FYN and FGR requires prior phosphorylation by SYK or FES. |
| Tissue Specificity: | Expressed only in tissues and cells of hematopoietic origin. |
| BioGrid: | 109309. 26 interactions. |
|
There are currently no product reviews
|













.png)










