Recombinant Human Left-right Determination Factor 1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LTGEQILGSLLQQLQLDQPPVLDKADVEGMVIPSHVRTQYVALLQHSHASRSRGKRHHHHHHFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
Source: Human Cells.
MW :39.2kD.
Recombinant Human Left-right Determination Factor 1 is produced by our Mammalian expression system and the target gene encoding Phe78-Pro366 is expressed with a 6His tag at the N-terminus. Lefty was first identified in a screen for undifferentiated cellspecific cDNAs from the P19 mouse embryonal carcinoma cells. Its mRNA expression on the left side of the developing embryo earned it the name “l e f t y”. Two genes exist in mouse (Lefty-1 and Lefty-2) and two in humans (Lefty-A(ebaf) and Lefty-B). Lefty contains the six cysteine residues that are conserved among TGF- beta related proteins and that are necessary to form the cysteine-knot structure. Lefty homologues have been identified in other vertebrate organisms including chick, frog, and zebrafish. Although the amino acid sequence identity is not well conserved among vertebrate species, the expression pattern of lefty on the left side is well conserved. Lefty-1 is expressed strongly on the left side of the prospective floor plate and weakly in the left half of the lateral plate mesoderm in E8 mice embryos. In all species examined, lefty proteins function in patterning leftright asymmetry of the developing organ systems such as the heart and lung. Lefty acts as an antagonist to Nodal signaling, potentially by competing for binding to a common receptor.
MW :39.2kD.
Recombinant Human Left-right Determination Factor 1 is produced by our Mammalian expression system and the target gene encoding Phe78-Pro366 is expressed with a 6His tag at the N-terminus. Lefty was first identified in a screen for undifferentiated cellspecific cDNAs from the P19 mouse embryonal carcinoma cells. Its mRNA expression on the left side of the developing embryo earned it the name “l e f t y”. Two genes exist in mouse (Lefty-1 and Lefty-2) and two in humans (Lefty-A(ebaf) and Lefty-B). Lefty contains the six cysteine residues that are conserved among TGF- beta related proteins and that are necessary to form the cysteine-knot structure. Lefty homologues have been identified in other vertebrate organisms including chick, frog, and zebrafish. Although the amino acid sequence identity is not well conserved among vertebrate species, the expression pattern of lefty on the left side is well conserved. Lefty-1 is expressed strongly on the left side of the prospective floor plate and weakly in the left half of the lateral plate mesoderm in E8 mice embryos. In all species examined, lefty proteins function in patterning leftright asymmetry of the developing organ systems such as the heart and lung. Lefty acts as an antagonist to Nodal signaling, potentially by competing for binding to a common receptor.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Nucleus |
| Post transnational modification: | Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing. |
| Tissue Specificity: | Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. |
| BioGrid: | 108538. 26 interactions. |
|
There are currently no product reviews
|








.png)








