Recombinant Human Macrophage Migration Inhibitory Factor/MIF
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Source: E. coli.
MW :12.5kD.
Recombinant Human Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Met1-Ala115 is expressed. Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without asignal sequence .Secretion occurs nonclassically via an ABCA1 transporter.Pro-inflammatory cytokine.Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites ofinflammation suggests a role as mediator in regulating the function of acrophages in host defense.Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase anddopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clearwhether the tautomerase activity has any physiological relevance, and whether it is important for cytokineactivity.
MW :12.5kD.
Recombinant Human Macrophage migration inhibitory factor is produced by our E.coli expression system and the target gene encoding Met1-Ala115 is expressed. Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without asignal sequence .Secretion occurs nonclassically via an ABCA1 transporter.Pro-inflammatory cytokine.Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites ofinflammation suggests a role as mediator in regulating the function of acrophages in host defense.Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase anddopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clearwhether the tautomerase activity has any physiological relevance, and whether it is important for cytokineactivity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Cytoplasm |
| BioGrid: | 110428. 59 interactions. |
|
There are currently no product reviews
|




















.png)









